Lineage for d1k0xa_ (1k0x A:)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 165384Fold b.34: SH3-like barrel [50036] (10 superfamilies)
  4. 165426Superfamily b.34.2: SH3-domain [50044] (1 family) (S)
  5. 165427Family b.34.2.1: SH3-domain [50045] (23 proteins)
  6. 165571Protein Melanoma inhibitory activity protein [63746] (1 species)
  7. 165572Species Human (Homo sapiens) [TaxId:9606] [63747] (3 PDB entries)
  8. 165575Domain d1k0xa_: 1k0x A: [71977]

Details for d1k0xa_

PDB Entry: 1k0x (more details)

PDB Description: solution structure of melanoma inhibitory activity protein

SCOP Domain Sequences for d1k0xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1k0xa_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens)}
mgpmpkladrklcadqecshpismavalqdymapdcrfltihrgqvvyvfsklkgrgrlf
wggsvqgdyygdlaarlgyfpssivredqtlkpgkvdvktdkwdfycq

SCOP Domain Coordinates for d1k0xa_:

Click to download the PDB-style file with coordinates for d1k0xa_.
(The format of our PDB-style files is described here.)

Timeline for d1k0xa_: