Lineage for d1jymi_ (1jym I:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681775Fold d.167: Peptide deformylase [56419] (1 superfamily)
    alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix
  4. 1681776Superfamily d.167.1: Peptide deformylase [56420] (2 families) (S)
    nickel-dependent enzyme
  5. 1681777Family d.167.1.1: Peptide deformylase [56421] (2 proteins)
    automatically mapped to Pfam PF01327
  6. 1681778Protein Peptide deformylase [56422] (11 species)
  7. 1681839Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [75581] (3 PDB entries)
  8. 1681860Domain d1jymi_: 1jym I: [71965]
    complexed with co

Details for d1jymi_

PDB Entry: 1jym (more details), 2.8 Å

PDB Description: Crystals of Peptide Deformylase from Plasmodium falciparum with Ten Subunits per Asymmetric Unit Reveal Critical Characteristics of the Active Site for Drug Design
PDB Compounds: (I:) Peptide deformylase

SCOPe Domain Sequences for d1jymi_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jymi_ d.167.1.1 (I:) Peptide deformylase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
deikivkypdpilrrrsevtnfddnlkrvvrkmfdimyeskgiglsapqvniskriivwn
alyekrkeenerifinpsiveqslvklkliegclsfgiegkverpsivsisyydingykh
lkilkgihsrifqhefdhlngtlfidkmtqvdkkkvrpklnelirdykaths

SCOPe Domain Coordinates for d1jymi_:

Click to download the PDB-style file with coordinates for d1jymi_.
(The format of our PDB-style files is described here.)

Timeline for d1jymi_: