Lineage for d1jvub_ (1jvu B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1192691Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 1192692Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 1192693Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 1192791Protein Ribonuclease A (also ribonuclease B, S) [54078] (3 species)
  7. 1192792Species Cow (Bos taurus) [TaxId:9913] [54079] (149 PDB entries)
  8. 1192896Domain d1jvub_: 1jvu B: [71904]
    complexed with c2p

Details for d1jvub_

PDB Entry: 1jvu (more details), 1.78 Å

PDB Description: crystal structure of ribonuclease a (complexed form)
PDB Compounds: (B:) ribonuclease a

SCOPe Domain Sequences for d1jvub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jvub_ d.5.1.1 (B:) Ribonuclease A (also ribonuclease B, S) {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d1jvub_:

Click to download the PDB-style file with coordinates for d1jvub_.
(The format of our PDB-style files is described here.)

Timeline for d1jvub_: