Lineage for d1jqud_ (1jqu D:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1190374Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1190375Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1191083Family d.2.1.3: Phage lysozyme [53981] (4 proteins)
  6. 1191089Protein Phage T4 lysozyme [53982] (1 species)
  7. 1191090Species Bacteriophage T4 [TaxId:10665] [53983] (525 PDB entries)
    Uniprot P00720
    many mutant structures
  8. 1191670Domain d1jqud_: 1jqu D: [71799]

Details for d1jqud_

PDB Entry: 1jqu (more details), 2.6 Å

PDB Description: are carboxy terminii of helices coded by the local sequence or by tertiary structure contacts
PDB Compounds: (D:) lysozyme

SCOPe Domain Sequences for d1jqud_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jqud_ d.2.1.3 (D:) Phage T4 lysozyme {Bacteriophage T4 [TaxId: 10665]}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtldayknl

SCOPe Domain Coordinates for d1jqud_:

Click to download the PDB-style file with coordinates for d1jqud_.
(The format of our PDB-style files is described here.)

Timeline for d1jqud_: