Lineage for d1jquc_ (1jqu C:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 187287Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 187288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 187775Family d.2.1.3: Phage T4 lysozymes [53981] (2 proteins)
  6. 187776Protein Phage T4 lysozyme [53982] (1 species)
  7. 187777Species Bacteriophage T4 [TaxId:10665] [53983] (360 PDB entries)
  8. 188162Domain d1jquc_: 1jqu C: [71798]

Details for d1jquc_

PDB Entry: 1jqu (more details), 2.6 Å

PDB Description: are carboxy terminii of helices coded by the local sequence or by tertiary structure contacts

SCOP Domain Sequences for d1jquc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jquc_ d.2.1.3 (C:) Phage T4 lysozyme {Bacteriophage T4}
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtldayknl

SCOP Domain Coordinates for d1jquc_:

Click to download the PDB-style file with coordinates for d1jquc_.
(The format of our PDB-style files is described here.)

Timeline for d1jquc_: