SCOP 1.61: Domain d1jpxg_: 1jpx G:

Lineage for d1jpxg_ (1jpx G:)

1. Root: SCOP 1.61

2. Class h: Coiled coil proteins [57942] (5 folds)

3. Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)

4. Superfamily h.3.2: Virus ectodomain [58069] (1 family)

5. Family h.3.2.1: Virus ectodomain [58070] (6 proteins)

6. Protein Retrovius gp41 protease-resistant core [58071] (3 species)

7. Species Simian immunodeficiency virus [58073] (10 PDB entries)

8. Domain d1jpxg_: 1jpx G: [71785]

Details for d1jpxg_

PDB Entry: 1jpx, 2.3 Å

PDB Description: mutation that destabilize the gp41 core: determinants for stabilizing the siv/cpmac envelope glycoprotein complex. wild type.

SCOP Domain Sequences for d1jpxg_:

Sequence, based on SEQRES records:

>d1jpxg_ h.3.2.1 (G:) Retrovius gp41 protease-resistant core {Simian immunodeficiency virus}
givqqqqqlldvvkrqqellrltvwgtknlqtrvtsggrggwqewerkvdfleenitall
eeaqiqqekn

Sequence, based on observed residues (ATOM records):

>d1jpxg_ h.3.2.1 (G:) Retrovius gp41 protease-resistant core {Simian immunodeficiency virus}
givqqqqqlldvvkrqqellrltvwgtkqewerkvdfleenitalleeaqiqqekn

Timeline for d1jpxg_:

• d1jpxg_ is new in SCOP 1.61
  
• d1jpxg_ appears in SCOP 1.63
  
• d1jpxg_ appears in the current release, SCOPe 2.08