SCOPe 2.05: Domain d1jnda2: 1jnd A:279-370

Lineage for d1jnda2 (1jnd A:279-370)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.3: Chitinase insertion domain [54556] (1 family)

5. Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins)

6. Protein Imaginal disc growth factor-2 [75392] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [75393] (2 PDB entries)

8. Domain d1jnda2: 1jnd A:279-370 [71758]
   Other proteins in same PDB: d1jnda1
   complexed with man

Details for d1jnda2

PDB Entry: 1jnd, 1.3 Å

PDB Description: crystal structure of imaginal disc growth factor-2

PDB Compounds: (A:) Imaginal disc growth factor-2

SCOPe Domain Sequences for d1jnda2:

Sequence; same for both SEQRES and ATOM records:

>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ygnawkltkdsglegvpvvpetsgpapegfqsqkpgllsyaeicgklsnpqnqflkgnes
plrrvsdptkrfggiayrpvdgqitegiwvsy

Timeline for d1jnda2:

• d1jnda2 first appeared in SCOP 1.61
  
• d1jnda2 appears in SCOPe 2.04
  
• d1jnda2 appears in SCOPe 2.06
  
• d1jnda2 appears in the current release, SCOPe 2.08