Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) |
Family d.26.3.1: Chitinase insertion domain [54557] (10 proteins) |
Protein Imaginal disc growth factor-2 [75392] (1 species) |
Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [75393] (2 PDB entries) |
Domain d1jnda2: 1jnd A:279-370 [71758] Other proteins in same PDB: d1jnda1 complexed with man |
PDB Entry: 1jnd (more details), 1.3 Å
SCOPe Domain Sequences for d1jnda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} ygnawkltkdsglegvpvvpetsgpapegfqsqkpgllsyaeicgklsnpqnqflkgnes plrrvsdptkrfggiayrpvdgqitegiwvsy
Timeline for d1jnda2: