Lineage for d1jnda2 (1jnd A:279-370)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.26: FKBP-like [54533] (3 superfamilies) Superfamily d.26.3: Chitinase insertion domain [54556] (1 family) 
Family d.26.3.1: Chitinase insertion domain [54557] (6 proteins) 
Protein Imaginal disc growth factor-2 [75392] (1 species) Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [75393] (2 PDB entries) 
Domain d1jnda2: 1jnd A:279-370 [71758]
Other proteins in same PDB: d1jnda1
Details for d1jnda2
PDB Entry: 1jnd (more details), 1.3 Å
PDB Description: crystal structure of imaginal disc growth factor-2
SCOP Domain Sequences for d1jnda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnda2 d.26.3.1 (A:279-370) Imaginal disc growth factor-2 {Fruit fly (Drosophila melanogaster)}
ygnawkltkdsglegvpvvpetsgpapegfqsqkpgllsyaeicgklsnpqnqflkgnes
plrrvsdptkrfggiayrpvdgqitegiwvsy
SCOP Domain Coordinates for d1jnda2:
Click to download the PDB-style file with coordinates for d1jnda2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jnda2:
- d1jnda2 is new in SCOP 1.61
- d1jnda2 appears in SCOP 1.63
- d1jnda2 appears in the current release, SCOPe 2.08
View in 3D
