Lineage for d1jn1b_ (1jn1 B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193619Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
  4. 193739Superfamily d.79.5: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69765] (1 family) (S)
  5. 193740Family d.79.5.1: 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69766] (1 protein)
  6. 193741Protein 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF [69767] (2 species)
  7. 193749Species Haemophilus influenzae [TaxId:727] [75479] (1 PDB entry)
  8. 193751Domain d1jn1b_: 1jn1 B: [71755]

Details for d1jn1b_

PDB Entry: 1jn1 (more details), 2.9 Å

PDB Description: Structure of 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase from Haemophilus influenzae (HI0671)

SCOP Domain Sequences for d1jn1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jn1b_ d.79.5.1 (B:) 2C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF {Haemophilus influenzae}
mirighgfdvhafgedrpliiggvevpyhtgfiahsdgdvalhaltdailgaaalgdigk
lfpdtdmqyknadsrgllreafrqvqekgykignvditiiaqapkmrphidamrakiaed
lqcdieqvnvkattteklgftgrqegiaceavallir

SCOP Domain Coordinates for d1jn1b_:

Click to download the PDB-style file with coordinates for d1jn1b_.
(The format of our PDB-style files is described here.)

Timeline for d1jn1b_: