Lineage for d1jlwa1 (1jlw A:91-217)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1491601Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 1491602Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 1491603Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 1491777Protein Class delta GST [81355] (6 species)
    formerly a part of class theta enzymes
  7. 1491793Species Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId:123217] [74725] (1 PDB entry)
  8. 1491794Domain d1jlwa1: 1jlw A:91-217 [71741]
    Other proteins in same PDB: d1jlwa2, d1jlwb2

Details for d1jlwa1

PDB Entry: 1jlw (more details), 2.45 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-4
PDB Compounds: (A:) glutathione transferase GST1-4

SCOPe Domain Sequences for d1jlwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId: 123217]}
sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfgryft

SCOPe Domain Coordinates for d1jlwa1:

Click to download the PDB-style file with coordinates for d1jlwa1.
(The format of our PDB-style files is described here.)

Timeline for d1jlwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jlwa2