Lineage for d1jlwa1 (1jlw A:91-217)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 355982Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 355983Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 355984Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins)
  6. 356086Protein Class delta GST [81355] (5 species)
    formerly a part of class theta enzymes
  7. 356097Species Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId:123217] [74725] (1 PDB entry)
  8. 356098Domain d1jlwa1: 1jlw A:91-217 [71741]
    Other proteins in same PDB: d1jlwa2, d1jlwb2

Details for d1jlwa1

PDB Entry: 1jlw (more details), 2.45 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-4

SCOP Domain Sequences for d1jlwa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4}
sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfgryft

SCOP Domain Coordinates for d1jlwa1:

Click to download the PDB-style file with coordinates for d1jlwa1.
(The format of our PDB-style files is described here.)

Timeline for d1jlwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jlwa2