Class a: All alpha proteins [46456] (202 folds) |
Fold a.45: Glutathione S-transferase (GST), C-terminal domain [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: Glutathione S-transferase (GST), C-terminal domain [47616] (1 family) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (16 proteins) |
Protein Class delta GST [81355] (5 species) formerly a part of class theta enzymes |
Species Mosquito (Anopheles dirus b), isozyme 1-4 [TaxId:123217] [74725] (1 PDB entry) |
Domain d1jlwa1: 1jlw A:91-217 [71741] Other proteins in same PDB: d1jlwa2, d1jlwb2 |
PDB Entry: 1jlw (more details), 2.45 Å
SCOP Domain Sequences for d1jlwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jlwa1 a.45.1.1 (A:91-217) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-4} sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak vfgryft
Timeline for d1jlwa1: