Lineage for d1jlvf2 (1jlv F:1-84)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 991973Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 991974Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 992315Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)
  6. 992457Protein Class delta GST [81366] (5 species)
    formerly a part of class theta enzymes
  7. 992461Species Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId:123217] [75234] (1 PDB entry)
  8. 992467Domain d1jlvf2: 1jlv F:1-84 [71740]
    Other proteins in same PDB: d1jlva1, d1jlvb1, d1jlvc1, d1jlvd1, d1jlve1, d1jlvf1
    complexed with gsh

Details for d1jlvf2

PDB Entry: 1jlv (more details), 1.75 Å

PDB Description: Anopheles dirus species B glutathione S-transferases 1-3
PDB Compounds: (F:) glutathione transferase GST1-3

SCOPe Domain Sequences for d1jlvf2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jlvf2 c.47.1.5 (F:1-84) Class delta GST {Mosquito (Anopheles dirus b), isozyme 1-3 [TaxId: 123217]}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflkinpqhciptlvdngf
alwesraictylaekygkddklyp

SCOPe Domain Coordinates for d1jlvf2:

Click to download the PDB-style file with coordinates for d1jlvf2.
(The format of our PDB-style files is described here.)

Timeline for d1jlvf2: