Lineage for d1jkvc_ (1jkv C:)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 441060Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 441061Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 441621Family a.25.1.3: Manganese catalase (T-catalase) [100951] (1 protein)
  6. 441622Protein Manganese catalase (T-catalase) [47263] (1 species)
  7. 441623Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries)
  8. 441626Domain d1jkvc_: 1jkv C: [71721]

Details for d1jkvc_

PDB Entry: 1jkv (more details), 1.39 Å

PDB Description: crystal structure of manganese catalase from lactobacillus plantarum complexed with azide

SCOP Domain Sequences for d1jkvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkvc_ a.25.1.3 (C:) Manganese catalase (T-catalase) {Lactobacillus plantarum}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

SCOP Domain Coordinates for d1jkvc_:

Click to download the PDB-style file with coordinates for d1jkvc_.
(The format of our PDB-style files is described here.)

Timeline for d1jkvc_: