SCOP 1.69: Domain d1jkvd_: 1jkv D:

Lineage for d1jkvd_ (1jkv D:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.3: Manganese catalase (T-catalase) [100951] (1 protein)

6. Protein Manganese catalase (T-catalase) [47263] (1 species)

7. Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries)

8. Domain d1jkvd_: 1jkv D: [71722]

Details for d1jkvd_

PDB Entry: 1jkv, 1.39 Å

PDB Description: crystal structure of manganese catalase from lactobacillus plantarum complexed with azide

SCOP Domain Sequences for d1jkvd_:

Sequence; same for both SEQRES and ATOM records:

>d1jkvd_ a.25.1.3 (D:) Manganese catalase (T-catalase) {Lactobacillus plantarum}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

Timeline for d1jkvd_:

• d1jkvd_ first appeared in SCOP 1.61
  
• d1jkvd_ appears in SCOP 1.67
  
• d1jkvd_ appears in SCOP 1.71
  
• d1jkvd_ appears in the current release, SCOPe 2.08