Lineage for d1jkuc_ (1jku C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2317020Family a.25.1.3: Manganese catalase (T-catalase) [100951] (2 proteins)
    automatically mapped to Pfam PF05067
  6. 2317021Protein Manganese catalase (T-catalase) [47263] (2 species)
  7. 2317022Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries)
  8. 2317037Domain d1jkuc_: 1jku C: [71715]
    complexed with ca, mn3, oh

Details for d1jkuc_

PDB Entry: 1jku (more details), 1.84 Å

PDB Description: Crystal Structure of Manganese Catalase from Lactobacillus plantarum
PDB Compounds: (C:) pseudocatalase

SCOPe Domain Sequences for d1jkuc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkuc_ a.25.1.3 (C:) Manganese catalase (T-catalase) {Lactobacillus plantarum [TaxId: 1590]}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

SCOPe Domain Coordinates for d1jkuc_:

Click to download the PDB-style file with coordinates for d1jkuc_.
(The format of our PDB-style files is described here.)

Timeline for d1jkuc_: