Lineage for d1jkub_ (1jku B:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 354330Family a.25.1.3: Manganese catalase (T-catalase) [100951] (1 protein)
  6. 354331Protein Manganese catalase (T-catalase) [47263] (1 species)
  7. 354332Species Lactobacillus plantarum [TaxId:1590] [74707] (3 PDB entries)
  8. 354346Domain d1jkub_: 1jku B: [71714]

Details for d1jkub_

PDB Entry: 1jku (more details), 1.84 Å

PDB Description: Crystal Structure of Manganese Catalase from Lactobacillus plantarum

SCOP Domain Sequences for d1jkub_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jkub_ a.25.1.3 (B:) Manganese catalase (T-catalase) {Lactobacillus plantarum}
mfkhtrklqynakpdrsdpimarrlqeslggqwgettgmmsylsqgwastgaekykdlll
dtgteemahvemistmigylledapfgpedlkrdpslattmagmdpehslvhglnaslnn
pngaawnagyvtssgnlvadmrfnvvresearlqvsrlysmtedegvrdmlkfllaretq
hqlqfmkaqeeleekygiivpgdmkeiehsefshvlmnfsdgdgskafegqvakdgekft
yqenpeamggiphikpgdprlhnhqg

SCOP Domain Coordinates for d1jkub_:

Click to download the PDB-style file with coordinates for d1jkub_.
(The format of our PDB-style files is described here.)

Timeline for d1jkub_: