Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.3: Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain [51800] (22 proteins) family members also share a common alpha+beta fold in C-terminal domain |
Protein Myo-inositol 1-phosphate synthase [75105] (4 species) |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [75107] (9 PDB entries) Uniprot P11986 |
Domain d1jkia1: 1jki A:9-322,A:438-533 [71704] Other proteins in same PDB: d1jkia2, d1jkib2 complexed with dg6, nai, nh4 |
PDB Entry: 1jki (more details), 2.2 Å
SCOPe Domain Sequences for d1jkia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jkia1 c.2.1.3 (A:9-322,A:438-533) Myo-inositol 1-phosphate synthase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} itsvkvvtdkctykdnelltkysyenavvtktasgrfdvtptvqdyvfkldlkkpeklgi mliglggnngstlvasvlankhnvefqtkegvkqpnyfgsmtqcstlklgidaegndvya pfnsllpmvspndfvvsgwdinnadlyeamqrsqvleydlqqrlkakmslvkplpsiyyp dfiaanqderanncinldekgnvttrgkwthlqrirrdiqnfkeenaldkvivlwtante ryvevspgvndtmenllqsikndheeiapstifaaasilegvpyingspqntfvpglvql aehegtfiagddlkXdsllatpliidllvmtefctrvsykkvdpvkedagkfenfypvlt flsywlkapltrpgfhpvnglnkqrtalenflrlliglpsqnelrfeerll
Timeline for d1jkia1: