Lineage for d1jizb1 (1jiz B:1-165)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2964231Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)
  6. 2964411Protein Macrophage elastase (MMP-12) [69780] (1 species)
  7. 2964412Species Human (Homo sapiens) [TaxId:9606] [69781] (58 PDB entries)
    Uniprot P39900 106-263 ! Uniprot P39900 106-264
  8. 2964475Domain d1jizb1: 1jiz B:1-165 [71694]
    Other proteins in same PDB: d1jiza2, d1jizb2
    complexed with ca, cgs, zn

Details for d1jizb1

PDB Entry: 1jiz (more details), 2.6 Å

PDB Description: Crystal Structure Analysis of human Macrophage Elastase MMP-12
PDB Compounds: (B:) macrophage elastase MMP-12

SCOPe Domain Sequences for d1jizb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jizb1 d.92.1.11 (B:1-165) Macrophage elastase (MMP-12) {Human (Homo sapiens) [TaxId: 9606]}
frempggpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadi
lvvfargahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavhe
ighslglghssdpkavmfptykyvdintfrlsaddirgiqslygd

SCOPe Domain Coordinates for d1jizb1:

Click to download the PDB-style file with coordinates for d1jizb1.
(The format of our PDB-style files is described here.)

Timeline for d1jizb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jizb2