Lineage for d1jizb_ (1jiz B:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.92: Zincin-like [55485] (2 superfamilies) Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) 
Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (11 proteins) Protein Macrophage elastase (MMP-12) [69780] (1 species) Species Human (Homo sapiens) [TaxId:9606] [69781] (2 PDB entries) 
Domain d1jizb_: 1jiz B: [71694]
Details for d1jizb_
PDB Entry: 1jiz (more details), 2.6 Å
PDB Description: Crystal Structure Analysis of human Macrophage Elastase MMP-12
SCOP Domain Sequences for d1jizb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jizb_ d.92.1.11 (B:) Macrophage elastase (MMP-12) {Human (Homo sapiens)}
gfrempggpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmad
ilvvfargahgdfhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavh
eighslglghssdpkavmfptykyvdintfrlsaddirgiqslygd
SCOP Domain Coordinates for d1jizb_:
Click to download the PDB-style file with coordinates for d1jizb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jizb_:
- d1jizb_ is new in SCOP 1.61
- d1jizb_ appears in SCOP 1.63
- d1jizb_ appears in the current release, SCOPe 2.08, called d1jizb1
View in 3D
