| Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
| Fold d.109: Gelsolin-like [55752] (3 superfamilies) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (3 families) ![]() |
| Family d.109.1.1: Gelsolin-like [55754] (5 proteins) |
| Protein Macrophage capping protein Cap G [75511] (1 species) |
| Species Human (Homo sapiens) [TaxId:9606] [75512] (2 PDB entries) |
| Domain d1jhwa1: 1jhw A:11-124 [71662] complexed with eu3; mutant |
PDB Entry: 1jhw (more details), 2.8 Å
SCOPe Domain Sequences for d1jhwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jhwa1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]}
pfpgsvqdpglhvwrveklkpvpvaqenqgvffsgdsylvlhngpeevshlhlwigqqss
rdeqgacavlavqlddylggrpvqhrevqgnesdlfmsyfprglkyqeggvesg
Timeline for d1jhwa1: