Class d: Alpha and beta proteins (a+b) [53931] (212 folds) |
Fold d.109: Actin depolymerizing proteins [55752] (1 superfamily) |
Superfamily d.109.1: Actin depolymerizing proteins [55753] (2 families) |
Family d.109.1.1: Gelsolin-like [55754] (4 proteins) |
Protein Macrophage capping protein Cap G [75511] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [75512] (1 PDB entry) |
Domain d1jhwa1: 1jhw A:11-124 [71662] |
PDB Entry: 1jhw (more details), 2.8 Å
SCOP Domain Sequences for d1jhwa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jhwa1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens)} pfpgsvqdpglhvwrveklkpvpvaqenqgvffsgdsylvlhngpeevshlhlwigqqss rdeqgacavlavqlddylggrpvqhrevqgnesdlfmsyfprglkyqeggvesg
Timeline for d1jhwa1: