SCOPe 2.07: Domain d1jfla2: 1jfl A:116-228

Lineage for d1jfla2 (1jfl A:116-228)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.2: Aspartate/glutamate racemase [53681] (2 families)

5. Family c.78.2.1: Aspartate/glutamate racemase [53682] (2 proteins)
   C-terminal extension is added to the N-terminal domain

6. Protein Aspartate racemase [75310] (1 species)

7. Species Pyrococcus horikoshii OT3 [TaxId:70601] [159783] (3 PDB entries)

8. Domain d1jfla2: 1jfl A:116-228 [71657]

Details for d1jfla2

PDB Entry: 1jfl, 1.9 Å

PDB Description: crystal structure determination of aspartate racemase from an archaea

PDB Compounds: (A:) aspartate racemase

SCOPe Domain Sequences for d1jfla2:

Sequence; same for both SEQRES and ATOM records:

>d1jfla2 c.78.2.1 (A:116-228) Aspartate racemase {Pyrococcus horikoshii OT3 [TaxId: 70601]}
fkkagllattgtivsgvyekefskygveimtptedeqkdvmrgiyegvkagnlklgrell
lktakileergaeciiagctevsvvlkqddlkvplidpmdviaevavkvalek

Timeline for d1jfla2:

• d1jfla2 first appeared in SCOP 1.61
  
• d1jfla2 appears in SCOPe 2.06
  
• d1jfla2 appears in the current release, SCOPe 2.08