SCOPe 2.03: Domain d1jb5a_: 1jb5 A:

Lineage for d1jb5a_ (1jb5 A:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.2: NTF2-like [54431] (6 proteins)

6. Protein Nuclear transport factor-2 (NTF2) [54432] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [54433] (10 PDB entries)
   Uniprot P61972

8. Domain d1jb5a_: 1jb5 A: [71628]
   mutant

Details for d1jb5a_

PDB Entry: 1jb5, 2.3 Å

PDB Description: crystal structure of ntf2 m118e mutant

PDB Compounds: (A:) nuclear transport factor 2

SCOPe Domain Sequences for d1jb5a_:

Sequence; same for both SEQRES and ATOM records:

>d1jb5a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
kpiweqigssfinhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndefrlal
hnf

Timeline for d1jb5a_:

• d1jb5a_ first appeared in SCOP 1.61
  
• d1jb5a_ appears in SCOPe 2.02
  
• d1jb5a_ appears in SCOPe 2.04
  
• d1jb5a_ appears in the current release, SCOPe 2.08