Lineage for d1jb5a_ (1jb5 A:)
- Root: SCOP 1.61
Class d: Alpha and beta proteins (a+b) [53931] (212 folds) 
Fold d.17: Cystatin-like [54402] (5 superfamilies) Superfamily d.17.4: NTF2-like [54427] (4 families) 
Family d.17.4.2: NTF2-like [54431] (3 proteins) Protein Nuclear transport factor-2 (NTF2) [54432] (3 species) 
Species Rat (Rattus norvegicus) [TaxId:10116] [54433] (9 PDB entries) 
Domain d1jb5a_: 1jb5 A: [71628]
Details for d1jb5a_
PDB Entry: 1jb5 (more details), 2.3 Å
PDB Description: crystal structure of ntf2 m118e mutant
SCOP Domain Sequences for d1jb5a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jb5a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus)}
kpiweqigssfinhyyqlfdndrtqlgaiyidascltwegqqfqgkaaiveklsslpfqk
iqhsitaqdhqptpdsciismvvgqlkadedpimgfhqmfllknindawvctndefrlal
hnf
SCOP Domain Coordinates for d1jb5a_:
Click to download the PDB-style file with coordinates for d1jb5a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jb5a_:
- d1jb5a_ is new in SCOP 1.61
- d1jb5a_ appears in SCOP 1.63
- d1jb5a_ appears in the current release, SCOPe 2.08
View in 3D
