SCOPe 2.05: Domain d1j9ia_: 1j9i A:

Lineage for d1j9ia_ (1j9i A:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.5: Terminase gpNU1 subunit domain [74696] (1 protein)
   automatically mapped to Pfam PF07471

6. Protein Terminase gpNU1 subunit domain [74697] (1 species)

7. Species Bacteriophage lambda [TaxId:10710] [74698] (1 PDB entry)

8. Domain d1j9ia_: 1j9i A: [71619]

Details for d1j9ia_

PDB Entry: 1j9i

PDB Description: structure of the dna binding domain of the gpnu1 subunit of lambda terminase

PDB Compounds: (A:) terminase small subunit

SCOPe Domain Sequences for d1j9ia_:

Sequence; same for both SEQRES and ATOM records:

>d1j9ia_ a.6.1.5 (A:) Terminase gpNU1 subunit domain {Bacteriophage lambda [TaxId: 10710]}
mevnkkqladifgasirtiqnwqeqgmpvlrgggkgnevlydsaavikwyaerdaeiene
klrrevee

Timeline for d1j9ia_:

• d1j9ia_ first appeared in SCOP 1.61
  
• d1j9ia_ appears in SCOPe 2.04
  
• d1j9ia_ appears in SCOPe 2.06
  
• d1j9ia_ appears in the current release, SCOPe 2.08