Lineage for d1j5da_ (1j5d A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2043106Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 2043107Superfamily b.6.1: Cupredoxins [49503] (8 families) (S)
    contains copper-binding site
  5. 2043108Family b.6.1.1: Plastocyanin/azurin-like [49504] (10 proteins)
    mono-domain proteins
  6. 2043513Protein Plastocyanin [49507] (16 species)
  7. 2043586Species Synechocystis sp. PCC 6803 [TaxId:1148] [49519] (6 PDB entries)
  8. 2043589Domain d1j5da_: 1j5d A: [71542]
    complexed with cu

Details for d1j5da_

PDB Entry: 1j5d (more details)

PDB Description: solution structure of oxidized paramagnetic cu(ii) plastocyanin from synechocystis pcc6803-minimized average structure
PDB Compounds: (A:) plastocyanin

SCOPe Domain Sequences for d1j5da_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1j5da_ b.6.1.1 (A:) Plastocyanin {Synechocystis sp. PCC 6803 [TaxId: 1148]}
anatvkmgsdsgalvfepstvtikageevkwvnnklsphnivfaadgvdadtaaklshkg
lafaagesftstftepgtytyycephrgagmvgkvvvd

SCOPe Domain Coordinates for d1j5da_:

Click to download the PDB-style file with coordinates for d1j5da_.
(The format of our PDB-style files is described here.)

Timeline for d1j5da_: