Lineage for d1iweb_ (1iwe B:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1162955Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1162956Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1164938Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 1164939Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
    common fold is interrupted by an all-alpha subdomain, residues 100-200
  7. 1164971Species Mouse (Mus musculus) [TaxId:10090] [69491] (9 PDB entries)
  8. 1164973Domain d1iweb_: 1iwe B: [71487]
    complexed with act, imp, mg

Details for d1iweb_

PDB Entry: 1iwe (more details), 2.1 Å

PDB Description: imp complex of the recombinant mouse-muscle adenylosuccinate synthetase
PDB Compounds: (B:) adenylosuccinate synthetase

SCOPe Domain Sequences for d1iweb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iweb_ c.37.1.10 (B:) Adenylosuccinate synthetase, PurA {Mouse (Mus musculus) [TaxId: 10090]}
aatgsrvtvvlgaqwgdegkgkvvdllatdadivsrcqggnnaghtvvvdgkeydfhllp
sgiintkavsfigngvvihlpglfeeaeknekkglkdwekrliisdrahlvfdfhqavdg
lqevqrqaqegknigttkkgigptysskaartglricdllsdfdefsarfknlahqhqsm
fptleidvegqlkrlkgfaerirpmvrdgvyfmyealhgppkkvlveganaalldidfgt
ypfvtssnctvggvctglgippqnigdvygvvkayttrvgigafpteqineigdllqnrg
hewgvttgrkrrcgwldlmilryahmvngftalaltkldildvlseikvgisyklngkri
pyfpanqeilqkveveyetlpgwkadttgarkwedlppqaqsyvrfvenhmgvavkwvgv
gksresmiqlf

SCOPe Domain Coordinates for d1iweb_:

Click to download the PDB-style file with coordinates for d1iweb_.
(The format of our PDB-style files is described here.)

Timeline for d1iweb_: