SCOPe 2.08: Domain d1ivvb2: 1ivv B:9-96

Lineage for d1ivvb2 (1ivv B:9-96)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.2: Amine oxidase N-terminal region [54416] (2 families)

5. Family d.17.2.1: Amine oxidase N-terminal region [54417] (2 proteins)
   duplication: contains two domains of this fold

6. Protein Copper amine oxidase, domains 1 and 2 [54418] (4 species)

7. Species Arthrobacter globiformis [TaxId:1665] [54421] (41 PDB entries)
   Uniprot P46881 9-628

8. Domain d1ivvb2: 1ivv B:9-96 [71454]
   Other proteins in same PDB: d1ivva1, d1ivvb1
   complexed with cu

Details for d1ivvb2

PDB Entry: 1ivv, 2.1 Å

PDB Description: crystal structure of copper amine oxidase from arthrobacter globiformis: early intermediate in topaquinone biogenesis

PDB Compounds: (B:) amine oxidase

SCOPe Domain Sequences for d1ivvb2:

Sequence; same for both SEQRES and ATOM records:

>d1ivvb2 d.17.2.1 (B:9-96) Copper amine oxidase, domains 1 and 2 {Arthrobacter globiformis [TaxId: 1665]}
aspfrlasageisevqgilrtagllgpekriaylgvldpargagseaedrrfrvfihdvs
garpqevtvsvtngtvisaveldtaatg

Timeline for d1ivvb2:

• d1ivvb2 first appeared in SCOP 1.61
  
• d1ivvb2 appears in SCOPe 2.07