Lineage for d1ivma_ (1ivm A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 497065Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 497066Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 497075Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 497127Protein Lysozyme [53961] (14 species)
    ubiquitous in a variety of tissues and secretions
  7. 497588Species Mouse (Mus musculus) [TaxId:10090] [75329] (1 PDB entry)
  8. 497589Domain d1ivma_: 1ivm A: [71442]
    lysozyme M

Details for d1ivma_

PDB Entry: 1ivm (more details)

PDB Description: solution structure of mouse lysozyme m

SCOP Domain Sequences for d1ivma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivma_ d.2.1.2 (A:) Lysozyme {Mouse (Mus musculus)}
kvyercefartlkrngmagyygvsladwvclaqhesnyntratnynrgdqstdygifqin
srywcndgktpravnacgincsallqdditaaiqcakrvvrdpqgirawvawrahcqnrd
lsqyirncgv

SCOP Domain Coordinates for d1ivma_:

Click to download the PDB-style file with coordinates for d1ivma_.
(The format of our PDB-style files is described here.)

Timeline for d1ivma_: