Lineage for d1ivma_ (1ivm A:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 187287Fold d.2: Lysozyme-like [53954] (1 superfamily)
  4. 187288Superfamily d.2.1: Lysozyme-like [53955] (7 families) (S)
  5. 187297Family d.2.1.2: C-type lysozyme [53960] (2 proteins)
  6. 187345Protein Lysozyme [53961] (16 species)
  7. 187738Species Mouse (Mus musculus) [TaxId:10090] [75329] (1 PDB entry)
  8. 187739Domain d1ivma_: 1ivm A: [71442]

Details for d1ivma_

PDB Entry: 1ivm (more details)

PDB Description: Solution structure of mouse lysozyme M

SCOP Domain Sequences for d1ivma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ivma_ d.2.1.2 (A:) Lysozyme {Mouse (Mus musculus)}
kvyercefartlkrngmagyygvsladwvclaqhesnyntratnynrgdqstdygifqin
srywcndgktpravnacgincsallqdditaaiqcakrvvrdpqgirawvawrahcqnrd
lsqyirncgv

SCOP Domain Coordinates for d1ivma_:

Click to download the PDB-style file with coordinates for d1ivma_.
(The format of our PDB-style files is described here.)

Timeline for d1ivma_: