Lineage for d1iufa1 (1iuf A:-2-75)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 905281Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 905282Superfamily a.4.1: Homeodomain-like [46689] (20 families) (S)
    consists only of helices
  5. 905636Family a.4.1.7: Centromere-binding [46756] (2 proteins)
    duplication: tandem repeat of two similar domains
  6. 905637Protein Ars-binding protein 1, ABP1 [74670] (1 species)
  7. 905638Species Fission yeast (Schizosaccharomyces pombe) [TaxId:4896] [74671] (1 PDB entry)
  8. 905639Domain d1iufa1: 1iuf A:-2-75 [71439]
    low resolution solution structure

Details for d1iufa1

PDB Entry: 1iuf (more details)

PDB Description: low resolution solution structure of the two dna-binding domains in schizosaccharomyces pombe abp1 protein
PDB Compounds: (A:) centromere abp1 protein

SCOPe Domain Sequences for d1iufa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iufa1 a.4.1.7 (A:-2-75) Ars-binding protein 1, ABP1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]}
gihmgkikrraitehekralrhyffqlqnrsgqqdliewfrekfgkdisqpsvsqilssk
ysyldntvekpwdvkrnr

SCOPe Domain Coordinates for d1iufa1:

Click to download the PDB-style file with coordinates for d1iufa1.
(The format of our PDB-style files is described here.)

Timeline for d1iufa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1iufa2