SCOP 1.69: Domain d1iu4d_: 1iu4 D:

Lineage for d1iu4d_ (1iu4 D:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (11 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.8: Microbial transglutaminase [75336] (1 protein)
   inverted positions of the catalytic triad Asp and His residues

6. Protein Microbial transglutaminase [75337] (1 species)

7. Species Streptoverticillium mobaraense [TaxId:35621] [75338] (1 PDB entry)

8. Domain d1iu4d_: 1iu4 D: [71433]

Details for d1iu4d_

PDB Entry: 1iu4, 2.4 Å

PDB Description: Crystal Structure Analysis of the Microbial Transglutaminase

SCOP Domain Sequences for d1iu4d_:

Sequence; same for both SEQRES and ATOM records:

>d1iu4d_ d.3.1.8 (D:) Microbial transglutaminase {Streptoverticillium mobaraense}
dsddrvtppaepldrmpdpyrpsygraetvvnnyirkwqqvyshrdgrkqqmteeqrewl
sygcvgvtwvnsgqyptnrlafasfdedrfknelkngrprsgetraefegrvakesfdee
kgfqrarevasvmnralenahdesayldnlkkelangndalrnedarspfysalrntpsf
kernggnhdpsrmkaviyskhfwsgqdrsssadkrkygdpdafrpapgtglvdmsrdrni
prsptspgegfvnfdygwfgaqteadadktvwthgnhyhapngslgamhvyeskfrnwse
gysdfdrgayvitfipkswntapdkvkqgwp

Timeline for d1iu4d_:

• d1iu4d_ first appeared in SCOP 1.61
  
• d1iu4d_ appears in SCOP 1.67
  
• d1iu4d_ appears in SCOP 1.71
  
• d1iu4d_ appears in the current release, SCOPe 2.08