![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.8: Microbial transglutaminase [75336] (1 protein) inverted positions of the catalytic triad Asp and His residues automatically mapped to Pfam PF09017 |
![]() | Protein Microbial transglutaminase [75337] (1 species) |
![]() | Species Streptoverticillium mobaraense [TaxId:35621] [75338] (1 PDB entry) |
![]() | Domain d1iu4d_: 1iu4 D: [71433] |
PDB Entry: 1iu4 (more details), 2.4 Å
SCOPe Domain Sequences for d1iu4d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1iu4d_ d.3.1.8 (D:) Microbial transglutaminase {Streptoverticillium mobaraense [TaxId: 35621]} dsddrvtppaepldrmpdpyrpsygraetvvnnyirkwqqvyshrdgrkqqmteeqrewl sygcvgvtwvnsgqyptnrlafasfdedrfknelkngrprsgetraefegrvakesfdee kgfqrarevasvmnralenahdesayldnlkkelangndalrnedarspfysalrntpsf kernggnhdpsrmkaviyskhfwsgqdrsssadkrkygdpdafrpapgtglvdmsrdrni prsptspgegfvnfdygwfgaqteadadktvwthgnhyhapngslgamhvyeskfrnwse gysdfdrgayvitfipkswntapdkvkqgwp
Timeline for d1iu4d_: