Lineage for d1iu4d_ (1iu4 D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2926589Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 2926590Superfamily d.3.1: Cysteine proteinases [54001] (24 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 2927322Family d.3.1.8: Microbial transglutaminase [75336] (1 protein)
    inverted positions of the catalytic triad Asp and His residues
    automatically mapped to Pfam PF09017
  6. 2927323Protein Microbial transglutaminase [75337] (1 species)
  7. 2927324Species Streptoverticillium mobaraense [TaxId:35621] [75338] (1 PDB entry)
  8. 2927328Domain d1iu4d_: 1iu4 D: [71433]

Details for d1iu4d_

PDB Entry: 1iu4 (more details), 2.4 Å

PDB Description: Crystal Structure Analysis of the Microbial Transglutaminase
PDB Compounds: (D:) microbial transglutaminase

SCOPe Domain Sequences for d1iu4d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1iu4d_ d.3.1.8 (D:) Microbial transglutaminase {Streptoverticillium mobaraense [TaxId: 35621]}
dsddrvtppaepldrmpdpyrpsygraetvvnnyirkwqqvyshrdgrkqqmteeqrewl
sygcvgvtwvnsgqyptnrlafasfdedrfknelkngrprsgetraefegrvakesfdee
kgfqrarevasvmnralenahdesayldnlkkelangndalrnedarspfysalrntpsf
kernggnhdpsrmkaviyskhfwsgqdrsssadkrkygdpdafrpapgtglvdmsrdrni
prsptspgegfvnfdygwfgaqteadadktvwthgnhyhapngslgamhvyeskfrnwse
gysdfdrgayvitfipkswntapdkvkqgwp

SCOPe Domain Coordinates for d1iu4d_:

Click to download the PDB-style file with coordinates for d1iu4d_.
(The format of our PDB-style files is described here.)

Timeline for d1iu4d_: