Class e: Multi-domain proteins (alpha and beta) [56572] (39 folds) |
Fold e.36: Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains [75603] (1 superfamily) 3 domains: (1 and 2) alpha+beta; (3) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
Superfamily e.36.1: Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains [75604] (1 family) |
Family e.36.1.1: Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains [75605] (1 protein) |
Protein Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains [75606] (1 species) the N-terminal domain is homologous to (queosine) tRNA-guanine transglycosylase |
Species Archaeon Pyrococcus horikoshii [TaxId:53953] [75607] (3 PDB entries) |
Domain d1it7b2: 1it7 B:361-582 [71412] Other proteins in same PDB: d1it7a1, d1it7b1 complexed with gun, mg, zn |
PDB Entry: 1it7 (more details), 2.3 Å
SCOP Domain Sequences for d1it7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1it7b2 e.36.1.1 (B:361-582) Archaeosine tRNA-guanine transglycosylase, C-terminal additional domains {Archaeon Pyrococcus horikoshii} pitkksalfkisneslrwpvvrrakeraksinerfgelvehpifgrvsrylsltypfaqs eaeddfkiekptkedaikyvmaiaeyqfgegasrafddakvelsktgmprqvkvngkrla tvraddglltlgiegakrlhrvlpyprmrvvvnkeaepfarkgkdvfakfvifadpgirp ydevlvvnendellatgqallsgremivfqygravkvrkgve
Timeline for d1it7b2: