| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.159: Metallo-dependent phosphatases [56299] (1 superfamily) 4 layers: alpha/beta/beta/alpha; mixed beta sheets; contains duplication |
Superfamily d.159.1: Metallo-dependent phosphatases [56300] (13 families) ![]() different families of this superfamily are groupped in a single Pfam family, Pfam PF00149 |
| Family d.159.1.3: Protein serine/threonine phosphatase [56310] (6 proteins) |
| Protein Protein phosphatase-1 (PP-1) [56311] (5 species) |
| Species Human (Homo sapiens), beta isoform [TaxId:9606] [64430] (5 PDB entries) Uniprot P36873 |
| Domain d1it6b_: 1it6 B: [71408] complexed with cyu, mn |
PDB Entry: 1it6 (more details), 2 Å
SCOPe Domain Sequences for d1it6b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1it6b_ d.159.1.3 (B:) Protein phosphatase-1 (PP-1) {Human (Homo sapiens), beta isoform [TaxId: 9606]}
lnidsiiqrllevrgskpgknvqlqeneirglclksreiflsqpilleleaplkicgdih
gqyydllrlfeyggfppesnylflgdyvdrgkqsleticlllaykikypenffllrgnhe
casinriygfydeckrryniklwktftdcfnclpiaaivdekifcchgglspdlqsmeqi
rrimrptdvpdqgllcdllwsdpdkdvlgwgendrgvsftfgaevvakflhkhdldlicr
ahqvvedgyeffakrqlvtlfsapnycgefdnagammsvdetlmcsfqilkpa
Timeline for d1it6b_: