![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) ![]() there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members |
![]() | Family c.23.14.3: ADP ribosyl cyclase-like [56630] (3 proteins) contains extra N-terminal all-alpha subdomain automatically mapped to Pfam PF02267 |
![]() | Protein Bone marror stromal cell antigen 1, BST-1/CD157 (ADP ribosyl cyclase-2) [75597] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [75598] (6 PDB entries) |
![]() | Domain d1isfa_: 1isf A: [71388] complexed with gol |
PDB Entry: 1isf (more details), 2.5 Å
SCOPe Domain Sequences for d1isfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1isfa_ c.23.14.3 (A:) Bone marror stromal cell antigen 1, BST-1/CD157 (ADP ribosyl cyclase-2) {Human (Homo sapiens) [TaxId: 9606]} wraegtsahlrdiflgrcaeyrallspeqrnkdctaiweafkvaldkdpcsvlpsdydlf itlsrhsiprdkslfwenshllvnsfadntrrfmplsdvlygrvadflswcrqkadsgld yqscptsedcennpvdsfwkrasiqyskdssgvihvmlngseptgaypikgffadyeipn lqkekitrieiwvmheiggpnvescgegsmkvlekrlkdmgfqyscindyrpvkllqcvd hsthpdcalk
Timeline for d1isfa_: