PDB entry 1isf

View 1isf on RCSB PDB site
Description: Crystal Structure Analysis of BST-1/CD157
Class: hydrolase
Keywords: ADP-ribosylcyclase, NAD glycohydrolase, cns, HYDROLASE
Deposited on 2001-12-05, released 2002-03-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bone marrow stromal cell antigen 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10588
      • engineered (33)
      • engineered (62)
      • engineered (115)
    Domains in SCOPe 2.08: d1isfa_
  • Chain 'B':
    Compound: bone marrow stromal cell antigen 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q10588
      • engineered (33)
      • engineered (62)
      • engineered (115)
    Domains in SCOPe 2.08: d1isfb_
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1isfA (A:)
    rwraegtsahlrdiflgrcaeyrallspeqrnkdctaiweafkvaldkdpcsvlpsdydl
    fitlsrhsiprdkslfwenshllvnsfadntrrfmplsdvlygrvadflswcrqkadsgl
    dyqscptsedcennpvdsfwkrasiqyskdssgvihvmlngseptgaypikgffadyeip
    nlqkekitrieiwvmheiggpnvescgegsmkvlekrlkdmgfqyscindyrpvkllqcv
    dhsthpdcalksaaaatqrkapsly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1isfA (A:)
    wraegtsahlrdiflgrcaeyrallspeqrnkdctaiweafkvaldkdpcsvlpsdydlf
    itlsrhsiprdkslfwenshllvnsfadntrrfmplsdvlygrvadflswcrqkadsgld
    yqscptsedcennpvdsfwkrasiqyskdssgvihvmlngseptgaypikgffadyeipn
    lqkekitrieiwvmheiggpnvescgegsmkvlekrlkdmgfqyscindyrpvkllqcvd
    hsthpdcalk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1isfB (B:)
    rwraegtsahlrdiflgrcaeyrallspeqrnkdctaiweafkvaldkdpcsvlpsdydl
    fitlsrhsiprdkslfwenshllvnsfadntrrfmplsdvlygrvadflswcrqkadsgl
    dyqscptsedcennpvdsfwkrasiqyskdssgvihvmlngseptgaypikgffadyeip
    nlqkekitrieiwvmheiggpnvescgegsmkvlekrlkdmgfqyscindyrpvkllqcv
    dhsthpdcalksaaaatqrkapsly
    

    Sequence, based on observed residues (ATOM records): (download)
    >1isfB (B:)
    wraegtsahlrdiflgrcaeyrallspeqrnkdctaiweafkvaldkdpcsvlpsdydlf
    itlsrhsiprdkslfwenshllvnsfadntrrfmplsdvlygrvadflswcrqkadsgld
    yqscptsedcennpvdsfwkrasiqyskdssgvihvmlngseptgaypikgffadyeipn
    lqkekitrieiwvmheiggpnvescgegsmkvlekrlkdmgfqyscindyrpvkllqcvd
    hsthpdcalk