Lineage for d1irup_ (1iru P:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 197693Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
  4. 197694Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
  5. 197799Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 197868Protein Proteasome alpha subunit (non-catalytic) [56255] (3 species)
  7. 197941Species Cow (Bos taurus) [TaxId:9913] [75568] (1 PDB entry)
  8. 197950Domain d1irup_: 1iru P: [71367]
    Other proteins in same PDB: d1iru1_, d1iru2_, d1iruh_, d1irui_, d1iruj_, d1iruk_, d1irul_, d1irum_, d1irun_, d1iruv_, d1iruw_, d1irux_, d1iruy_, d1iruz_

Details for d1irup_

PDB Entry: 1iru (more details), 2.75 Å

PDB Description: Crystal Structure of the mammalian 20S proteasome at 2.75 A resolution

SCOP Domain Sequences for d1irup_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1irup_ d.153.1.4 (P:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus)}
aergysfslttfspsgklvqieyalaavaggapsvgikaangvvlatekkqksilyders
vhkvepitkhiglvysgmgpdyrvlvhrarklaqqyylvyqepiptaqlvqrvasvmqey
tqsggvrpfgvsllicgwnegrpylfqsdpsgayfawkatamgknyvngktflekryned
leledaihtailtlkesfegqmtednievgicneagfrrltptevkdylaaia

SCOP Domain Coordinates for d1irup_:

Click to download the PDB-style file with coordinates for d1irup_.
(The format of our PDB-style files is described here.)

Timeline for d1irup_: