Lineage for d1ipaa2 (1ipa A:1-105)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 193619Fold d.79: Bacillus chorismate mutase-like [55297] (5 superfamilies)
  4. 193699Superfamily d.79.3: L30e-like [55315] (3 families) (S)
  5. 193727Family d.79.3.3: RNA 2'-O ribose methyltransferase substrate binding domain [75480] (1 protein)
  6. 193728Protein RrmH, N-terminal domain [75481] (1 species)
  7. 193729Species Thermus thermophilus [TaxId:274] [75482] (1 PDB entry)
  8. 193730Domain d1ipaa2: 1ipa A:1-105 [71255]
    Other proteins in same PDB: d1ipaa1

Details for d1ipaa2

PDB Entry: 1ipa (more details), 2.4 Å

PDB Description: crystal structure of rna 2'-o ribose methyltransferase

SCOP Domain Sequences for d1ipaa2:

Sequence, based on SEQRES records: (download)

>d1ipaa2 d.79.3.3 (A:1-105) RrmH, N-terminal domain {Thermus thermophilus}
mritstanprikelarllerkhrdsqrrfliegareieralqagieleqalvwegglnpe
eqqvyaalgrvgrlallevseavlkklsvrdnpaglialarmper

Sequence, based on observed residues (ATOM records): (download)

>d1ipaa2 d.79.3.3 (A:1-105) RrmH, N-terminal domain {Thermus thermophilus}
mritstanprikelarllerkhrdsqrrfliegareieralqagieleqalvwegglnpe
eqqvyaallallevseavlkklsvrdnpaglialarmper

SCOP Domain Coordinates for d1ipaa2:

Click to download the PDB-style file with coordinates for d1ipaa2.
(The format of our PDB-style files is described here.)

Timeline for d1ipaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ipaa1