Lineage for d1ioob_ (1ioo B:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1039774Fold d.124: Ribonuclease Rh-like [55894] (1 superfamily)
    alpha+beta fold
  4. 1039775Superfamily d.124.1: Ribonuclease Rh-like [55895] (1 family) (S)
  5. 1039776Family d.124.1.1: Ribonuclease Rh-like [55896] (9 proteins)
  6. 1039777Protein Gemetophytic self-incompatibility associated SF11-RNase [75537] (1 species)
  7. 1039778Species Winged tobacco (Nicotiana alata) [TaxId:4087] [75538] (1 PDB entry)
  8. 1039780Domain d1ioob_: 1ioo B: [71251]

Details for d1ioob_

PDB Entry: 1ioo (more details), 1.55 Å

PDB Description: crystal structure of nicotiana alata gemetophytic self-incompatibility associated sf11-rnase
PDB Compounds: (B:) sf11-RNAse

SCOPe Domain Sequences for d1ioob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ioob_ d.124.1.1 (B:) Gemetophytic self-incompatibility associated SF11-RNase {Winged tobacco (Nicotiana alata) [TaxId: 4087]}
dfeylqlvltwpasfcyanhceriapnnftihglwpdnvktrlhnckpkptysyftgkml
ndldkhwmqlkfeqdygrteqpswkyqyikhgsccqkrynqntyfglalrlkdkfdllrt
lqthriipgssytfqdifdaiktvsqenpdikcaevtkgtpelyeigicftpnadsmfrc
pqsdtcdktakvlfrr

SCOPe Domain Coordinates for d1ioob_:

Click to download the PDB-style file with coordinates for d1ioob_.
(The format of our PDB-style files is described here.)

Timeline for d1ioob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1iooa_