Lineage for d1ijjb1 (1ijj B:404-546)

  1. Root: SCOP 1.61
  2. 172677Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 181999Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
  4. 182000Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families) (S)
  5. 182001Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)
  6. 182002Protein Actin [53073] (5 species)
  7. 182016Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (9 PDB entries)
  8. 182035Domain d1ijjb1: 1ijj B:404-546 [71232]

Details for d1ijjb1

PDB Entry: 1ijj (more details), 2.85 Å

PDB Description: the x-ray crystal structure of the complex between rabbit skeletal muscle actin and latrunculin a at 2.85 a resolution

SCOP Domain Sequences for d1ijjb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijjb1 c.55.1.1 (B:404-546) Actin {Rabbit (Oryctolagus cuniculus)}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

SCOP Domain Coordinates for d1ijjb1:

Click to download the PDB-style file with coordinates for d1ijjb1.
(The format of our PDB-style files is described here.)

Timeline for d1ijjb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ijjb2