SCOP 1.61: Domain d1ijjb1: 1ijj B:404-546

Lineage for d1ijjb1 (1ijj B:404-546)

1. Root: SCOP 1.61

2. Class c: Alpha and beta proteins (a/b) [51349] (117 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (5 families)

5. Family c.55.1.1: Actin/HSP70 [53068] (6 proteins)

6. Protein Actin [53073] (5 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (9 PDB entries)

8. Domain d1ijjb1: 1ijj B:404-546 [71232]

Details for d1ijjb1

PDB Entry: 1ijj, 2.85 Å

PDB Description: the x-ray crystal structure of the complex between rabbit skeletal muscle actin and latrunculin a at 2.85 a resolution

SCOP Domain Sequences for d1ijjb1:

Sequence; same for both SEQRES and ATOM records:

>d1ijjb1 c.55.1.1 (B:404-546) Actin {Rabbit (Oryctolagus cuniculus)}
ettalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrg
iltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqim
fetfnvpamyvaiqavlslyasg

Timeline for d1ijjb1:

• d1ijjb1 is new in SCOP 1.61
  
• d1ijjb1 appears in SCOP 1.63
  
• d1ijjb1 appears in the current release, SCOPe 2.08