Lineage for d1ijja2 (1ijj A:147-374)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 245987Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 245988Superfamily c.55.1: Actin-like ATPase domain [53067] (6 families) (S)
    duplication contains two domains of this fold
  5. 245989Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 245990Protein Actin [53073] (6 species)
  7. 246009Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (10 PDB entries)
  8. 246031Domain d1ijja2: 1ijj A:147-374 [71231]

Details for d1ijja2

PDB Entry: 1ijj (more details), 2.85 Å

PDB Description: the x-ray crystal structure of the complex between rabbit skeletal muscle actin and latrunculin a at 2.85 a resolution

SCOP Domain Sequences for d1ijja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ijja2 c.55.1.1 (A:147-374) Actin {Rabbit (Oryctolagus cuniculus)}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc

SCOP Domain Coordinates for d1ijja2:

Click to download the PDB-style file with coordinates for d1ijja2.
(The format of our PDB-style files is described here.)

Timeline for d1ijja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ijja1