| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
| Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
| Protein von Willebrand factor A1 domain, vWA1 [53306] (2 species) |
| Species Human (Homo sapiens) [TaxId:9606] [53307] (10 PDB entries) |
| Domain d1ijba_: 1ijb A: [71229] mutant |
PDB Entry: 1ijb (more details), 1.8 Å
SCOPe Domain Sequences for d1ijba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ijba_ c.62.1.1 (A:) von Willebrand factor A1 domain, vWA1 {Human (Homo sapiens) [TaxId: 9606]}
sepplhdfycsrlldlvflldgssrlseaefevlkafvvdmmerlrvsqkwvrvavveyh
dgshayiglkdrkrpselrriasqvkyagsqvastsevlkytlfqifskidrpeasrial
llmasqepqrmsrnfvryvqglkkkkvivipvgigphanlkqirliekqapenkafvlss
vdeleqqrdeivsylcdlapea
Timeline for d1ijba_: