![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families) ![]() |
![]() | Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins) |
![]() | Protein Xylanase II [49979] (17 species) Partial overlap with common fold and the active sites of the other endoglucanases |
![]() | Species Bacillus subtilis, B230 [TaxId:1423] [74910] (1 PDB entry) |
![]() | Domain d1igob_: 1igo B: [71210] complexed with so4 |
PDB Entry: 1igo (more details), 2.2 Å
SCOP Domain Sequences for d1igob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igob_ b.29.1.11 (B:) Xylanase II {Bacillus subtilis, B230 [TaxId: 1423]} attitsnqtgthdgydyelwkdsgntsmtlnsggafsaqwsnignalfrkgkkfdstkth sqlgnisinynatfnpggnsylcvygwtkdplteyyivdnwgtyrptgtpkgtftvdggt ydiyettrinqpsiigiatfkqywsvrqtkrtsgtvsvsehfkkweslgmpmgkmyetal tvegyqsngsanvtanvltiggkpl
Timeline for d1igob_: