SCOP 1.73: Domain d1igoa_: 1igo A:

Lineage for d1igoa_ (1igo A:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)

6. Protein Xylanase II [49979] (16 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Bacillus subtilis, B230 [TaxId:1423] [74910] (1 PDB entry)

8. Domain d1igoa_: 1igo A: [71209]

Details for d1igoa_

PDB Entry: 1igo, 2.2 Å

PDB Description: Family 11 xylanase

PDB Compounds: (A:) family 11 xylanase

SCOP Domain Sequences for d1igoa_:

Sequence; same for both SEQRES and ATOM records:

>d1igoa_ b.29.1.11 (A:) Xylanase II {Bacillus subtilis, B230 [TaxId: 1423]}
attitsnqtgthdgydyelwkdsgntsmtlnsggafsaqwsnignalfrkgkkfdstkth
sqlgnisinynatfnpggnsylcvygwtkdplteyyivdnwgtyrptgtpkgtftvdggt
ydiyettrinqpsiigiatfkqywsvrqtkrtsgtvsvsehfkkweslgmpmgkmyetal
tvegyqsngsanvtanvltiggkpl

Timeline for d1igoa_:

• d1igoa_ first appeared in SCOP 1.61
  
• d1igoa_ appears in SCOP 1.71
  
• d1igoa_ appears in SCOP 1.75
  
• d1igoa_ appears in the current release, SCOPe 2.08