Lineage for d1igoa_ (1igo A:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 556586Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (2 proteins)
  6. 556625Protein Xylanase II [49979] (16 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 556659Species Bacillus subtilis, B230 [TaxId:1423] [74910] (1 PDB entry)
  8. 556660Domain d1igoa_: 1igo A: [71209]

Details for d1igoa_

PDB Entry: 1igo (more details), 2.2 Å

PDB Description: Family 11 xylanase

SCOP Domain Sequences for d1igoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igoa_ b.29.1.11 (A:) Xylanase II {Bacillus subtilis, B230}
attitsnqtgthdgydyelwkdsgntsmtlnsggafsaqwsnignalfrkgkkfdstkth
sqlgnisinynatfnpggnsylcvygwtkdplteyyivdnwgtyrptgtpkgtftvdggt
ydiyettrinqpsiigiatfkqywsvrqtkrtsgtvsvsehfkkweslgmpmgkmyetal
tvegyqsngsanvtanvltiggkpl

SCOP Domain Coordinates for d1igoa_:

Click to download the PDB-style file with coordinates for d1igoa_.
(The format of our PDB-style files is described here.)

Timeline for d1igoa_: