Lineage for d1icha_ (1ich A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 918821Fold a.77: DEATH domain [47985] (1 superfamily)
    6 helices: closed bundle; greek-key; internal pseudo twofold symmetry
  4. 918822Superfamily a.77.1: DEATH domain [47986] (4 families) (S)
  5. 918823Family a.77.1.2: DEATH domain, DD [81312] (9 proteins)
    Pfam PF00531
  6. 918859Protein Tumor necrosis factor receptor-1 death domain [74741] (1 species)
  7. 918860Species Human (Homo sapiens) [TaxId:9606] [74742] (1 PDB entry)
  8. 918861Domain d1icha_: 1ich A: [71182]

Details for d1icha_

PDB Entry: 1ich (more details)

PDB Description: solution structure of the tumor necrosis factor receptor-1 death domain
PDB Compounds: (A:) tumor necrosis factor receptor-1

SCOPe Domain Sequences for d1icha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1icha_ a.77.1.2 (A:) Tumor necrosis factor receptor-1 death domain {Human (Homo sapiens) [TaxId: 9606]}
patlyavvenvpplrwkefvkrlglsdheidrlelqngrclreaqysmlatwrrrtprre
atlellgrvlrdmdllgcledieealc

SCOPe Domain Coordinates for d1icha_:

Click to download the PDB-style file with coordinates for d1icha_.
(The format of our PDB-style files is described here.)

Timeline for d1icha_: