SCOPe 2.04: Domain d1ibv.1: 1ibv A:,B:

Lineage for d1ibv.1 (1ibv A:,B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.155: Pyruvoyl-dependent histidine and arginine decarboxylases [56270] (1 superfamily)
   duplication of beta-alpha-beta(2) motif; 4 layers: alpha/beta/beta/alpha; contains "silk" beta-sandwich

4. Superfamily d.155.1: Pyruvoyl-dependent histidine and arginine decarboxylases [56271] (2 families)
   two chains result from self-processing single-chain precursor; form heterohexamer

5. Family d.155.1.1: Histidine decarboxylase [56272] (1 protein)
   automatically mapped to Pfam PF02329

6. Protein Histidine decarboxylase [56273] (1 species)

7. Species Lactobacillus sp., strain 30a [TaxId:1591] [56274] (6 PDB entries)

8. Domain d1ibv.1: 1ibv A:,B: [71176]
   complexed with pvh, pyr; mutant

Details for d1ibv.1

PDB Entry: 1ibv, 2.5 Å

PDB Description: structure of the d53,54n mutant of histidine decarboxylase bound with histidine methyl ester at-170 c

PDB Compounds: (A:) histidine decarboxylase beta chain, (B:) histidine decarboxylase alpha chain

SCOPe Domain Sequences for d1ibv.1:

Sequence; same for both SEQRES and ATOM records:

>g1ibv.1 d.155.1.1 (A:,B:) Histidine decarboxylase {Lactobacillus sp., strain 30a [TaxId: 1591]}
seldaklnklgvdriaispykqwtrgymepgnigngyvtglkvdagvrdksdnnvldgiv
sydraetknayigqinmttasXftgvqgrvigydilrspevdkakplftetqwdgselpi
ydakplqdalveyfgteqdrrhypapgsfivcankgvtaerpkndadmkpgqgygvwsai
aisfakdptkdssmfvedagvwetpnedelleylegrrkamaksiaecgqdahasfessw
igfaytmmepgqignaitvapyvslpidsipggsiltpdkdmeimenltmpewlekmgyk
slsannalky

Timeline for d1ibv.1:

• d1ibv.1 first appeared in SCOP 1.61
  
• d1ibv.1 appears in SCOPe 2.03
  
• d1ibv.1 appears in SCOPe 2.05
  
• d1ibv.1 appears in the current release, SCOPe 2.08