Lineage for d1ibt.1 (1ibt A:,B:)

  1. Root: SCOP 1.61
  2. 187024Class d: Alpha and beta proteins (a+b) [53931] (212 folds)
  3. 198080Fold d.155: Histidine decarboxylase [56270] (1 superfamily)
  4. 198081Superfamily d.155.1: Histidine decarboxylase [56271] (1 family) (S)
  5. 198082Family d.155.1.1: Histidine decarboxylase [56272] (1 protein)
  6. 198083Protein Histidine decarboxylase [56273] (1 species)
  7. 198084Species Lactobacillus sp., strain 30a [TaxId:1591] [56274] (6 PDB entries)
  8. 198093Domain d1ibt.1: 1ibt A:,B: [71170]

Details for d1ibt.1

PDB Entry: 1ibt (more details), 2.6 Å

PDB Description: structure of the d53,54n mutant of histidine decarboxylase at-170 c

SCOP Domain Sequences for d1ibt.1:

Sequence; same for both SEQRES and ATOM records: (download)

>g1ibt.1 d.155.1.1 (A:,B:) Histidine decarboxylase {Lactobacillus sp., strain 30a}
seldaklnklgvdriaispykqwtrgymepgnigngyvtglkvdagvrdksdnnvldgiv
sydraetknayigqinmttasXsftgvqgrvigydilrspevdkakplftetqwdgselp
iydakplqdalveyfgteqdrrhypapgsfivcankgvtaerpkndadmkpgqgygvwsa
iaisfakdptkdssmfvedagvwetpnedelleylegrrkamaksiaecgqdahasfess
wigfaytmmepgqignaitvapyvslpidsipggsiltpdkdmeimenltmpewlekmgy
kslsannalky

SCOP Domain Coordinates for d1ibt.1:

Click to download the PDB-style file with coordinates for d1ibt.1.
(The format of our PDB-style files is described here.)

Timeline for d1ibt.1: