SCOP 1.61: Domain d1ib8a2: 1ib8 A:1-90

Lineage for d1ib8a2 (1ib8 A:1-90)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.52: Alpha-lytic protease prodomain-like [54805] (4 superfamilies)

4. Superfamily d.52.4: YhbC-like, N-terminal domain [75420] (1 family)

5. Family d.52.4.1: YhbC-like, N-terminal domain [75421] (1 protein)

6. Protein Hypothetical protein SP14.3 (SP0552) [75422] (1 species)

7. Species Streptococcus pneumoniae [TaxId:1313] [75423] (1 PDB entry)

8. Domain d1ib8a2: 1ib8 A:1-90 [71169]
   Other proteins in same PDB: d1ib8a1

Details for d1ib8a2

PDB Entry: 1ib8

PDB Description: solution structure and function of a conserved protein sp14.3 encoded by an essential streptococcus pneumoniae gene

SCOP Domain Sequences for d1ib8a2:

Sequence; same for both SEQRES and ATOM records:

>d1ib8a2 d.52.4.1 (A:1-90) Hypothetical protein SP14.3 (SP0552) {Streptococcus pneumoniae}
gsgvdaiativelvrevvepvieapfelvdieygkigsdmilsifvdkpegitlndtadl
temispvldtikpdpfpeqyfleitspgle

Timeline for d1ib8a2:

• d1ib8a2 is new in SCOP 1.61
  
• d1ib8a2 appears in SCOP 1.63
  
• d1ib8a2 appears in the current release, SCOPe 2.08